DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and try-3

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:235 Identity:68/235 - (28%)
Similarity:100/235 - (42%) Gaps:41/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNGNA 133
            ||||::|...||:|||||..:|:|.:...|..|..    ||....:.:..|:     |..:|...
 Worm    65 LCGATVIDDFWLVTAAHCALQLQTRSFVYVREPKN----NRERSFSVKEAYI-----HSGYNNQT 120

  Fly   134 GSDNIALLHVSESFEYNARVQQIALPDINDD------YSNKTAAAYGWGLT---DPDGDE---YS 186
            ..::||||.:|.... ...::.:.|  ::||      |.|  ....|:|||   |..|:.   .|
 Worm   121 ADNDIALLRISSDLS-KLGIKPVCL--VHDDSKLLKQYKN--GVVIGYGLTLGEDSSGEPKLINS 180

  Fly   187 KELQYAFAPLLNSTGC----KELLPADAPLTAQQVCSQV---KTCYGDGGTPLIYWPITGPAELV 244
            :.||....|:::...|    :.|......:|..|:|:..   .|..||.|.||:.....|  |.|
 Worm   181 QTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLHGTAPGDSGGPLLIHKSNG--EYV 243

  Fly   245 GLGSWSYMPCG------YANRPTVYTSVPPYIGWIHQTIG 278
            .:|..||...|      ....|.|||.:..|:.||...||
 Worm   244 QIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVIG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 66/231 (29%)
Tryp_SPc 41..273 CDD:214473 64/228 (28%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.