DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and Klk1b24

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:298 Identity:79/298 - (26%)
Similarity:119/298 - (39%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATYT-H 68
            |.|...|:|.|....|               .:|..::.|:..: .::.|:.|::    ..|. :
Mouse     4 LILFLALSLGGIDAAP---------------PVQSRVVGGFKCE-KNSQPWHVAV----FRYNKY 48

  Fly    69 LCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNV-----------TAAQVRYVDF 122
            :||..::...|:||||||                |....::.||           .:||.|:|..
Mouse    49 ICGGVLLNPNWVLTAAHC----------------YGNATSQYNVWLGKNKLFQREPSAQHRWVSK 97

  Fly   123 ASTHRSFNGNAGSDNI----------ALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGL 177
            :..|..:|.:..:|:|          .||.:||..:....|:.|.|| ..:.....|..|.|||.
Mouse    98 SFPHPDYNMSLLNDDIPQPKDKSNDLMLLRLSEPADITDAVKPIDLP-TEEPKLGSTCLASGWGS 161

  Fly   178 TDPDGDEYSKELQYAFAPLLNSTGC-KELL--PADAPLTAQQVCSQVKTCYGDGGTPLIYWPITG 239
            ..|...:...:||..|..||.:..| |..|  ..|..|.|.::.....||.||.|.|||...|  
Mouse   162 ITPTKWQKPNDLQCVFIKLLPNENCTKPYLHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGI-- 224

  Fly   240 PAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
               |.|:.||..:|||..|.|.:||.:..:..||..|:
Mouse   225 ---LHGITSWGPVPCGKPNAPAIYTKLIKFASWIKDTM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 71/259 (27%)
Tryp_SPc 41..273 CDD:214473 69/256 (27%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 69/257 (27%)
Tryp_SPc 25..258 CDD:238113 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.