DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:268 Identity:63/268 - (23%)
Similarity:105/268 - (39%) Gaps:68/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGT----PVYAGIINRSNVTA 114
            |:..||.:..   .|:||.::|..||::|||||      |..|::.:    .|:.|.:.:::...
Human   580 PWQASLQVRG---RHICGGALIADRWVITAAHC------FQEDSMASTVLWTVFLGKVWQNSRWP 635

  Fly   115 AQVRY-VDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDY------------- 165
            .:|.: |.....|.....::...::|||.:......:|.|:.:.||..:..:             
Human   636 GEVSFKVSRLLLHPYHEEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGA 700

  Fly   166 -------SNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQV-- 221
                   ::..|..|||         .::..:....|:.|:     |...|..|..|.:||:|  
Human   701 LREGALRADAVALFYGW---------RNQGSETCCCPISNA-----LQKVDVQLIPQDLCSEVYR 751

  Fly   222 -----------------KTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPY 269
                             ..|.||.|.||:...::|...|.||.||. :.||..|...|||.:...
Human   752 YQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGLVSWG-LGCGRPNYFGVYTRITGV 815

  Fly   270 IGWIHQTI 277
            |.||.|.:
Human   816 ISWIQQVV 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 62/265 (23%)
Tryp_SPc 41..273 CDD:214473 60/262 (23%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486
Tryp_SPc 568..822 CDD:238113 62/265 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.