DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and PRSS36

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:323 Identity:83/323 - (25%)
Similarity:123/323 - (38%) Gaps:83/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSPLFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEI-----QP--LIIDGYDVQGVDNVPYLVS 58
            :|.||.:|.:..:.||     .|...|..|::...::     :|  .|:.|.:.| ....|:.||
Human     5 LLLPLVMLVISPIPGA-----FQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQ-PGTWPWQVS 63

  Fly    59 LSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNG---------------------DAVGTPV 102
            |.....   |:||.|:|...|:|:||||.    ..||                     |...|..
Human    64 LHHGGG---HICGGSLIAPSWVLSAAHCF----MTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRA 121

  Fly   103 YAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSN 167
            .|.|:..:|.:..::                |:| :|||.::........|..:.||..:..:.:
Human   122 VAAIVVPANYSQVEL----------------GAD-LALLRLASPASLGPAVWPVCLPRASHRFVH 169

  Fly   168 KTAA-AYGWG-LTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAP--LTAQ----QVCS----- 219
            .||. |.||| :.:.|.......||.....||....|:.|.....|  ||.|    .:|:     
Human   170 GTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEG 234

  Fly   220 QVKTCYGDGGTPLI-----YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277
            :..||.||.|.||:     .|...|.... |.|      ||..|||.|:|:|..|..||.:.:
Human   235 RRDTCQGDSGGPLVCEEGGRWFQAGITSF-GFG------CGRRNRPGVFTAVATYEAWIREQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 73/273 (27%)
Tryp_SPc 41..273 CDD:214473 71/270 (26%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 71/271 (26%)
Tryp_SPc 47..289 CDD:238113 73/273 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.