DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and CG12256

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:283 Identity:87/283 - (30%)
Similarity:133/283 - (46%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLALAGAAKLPHIQHLTL-RDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLS-LTRA-TYTHLCG 71
            ||||.|....|....:.| :..|:.....|..::.||||...:.|||.||:. |||: ...|.||
  Fly    15 LLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCG 79

  Fly    72 ASIIGKRWLLTAAHCVDELRTFNG-DAVGTPVYAGI--INRSNVTAAQVRYVDFASTHRSFNGNA 133
            .|:|....:|||||||      || :|....|.|||  :|.|:...:||:..:....::..    
  Fly    80 GSLIAPNRVLTAAHCV------NGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQEL---- 134

  Fly   134 GSDNIALLHVSESFEYN-ARVQQIALPDINDDYSNKTAAAYGWGL-----TDPDGDEYSKELQYA 192
            .:.:||:|.:...||.: .||..|.:...:...:::.....|||.     |.|.. :|...||..
  Fly   135 VTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFA-KYPTVLQKL 198

  Fly   193 FAPLLNSTGCKELLPADAPLTAQQVCSQVK----TCYGDGGTPLIYWPITGPA-ELVGLGSWSYM 252
            ....|:::.|||.:   ..||..::|:..:    .|.||.|.||:.  .:|.: :.||:.|:...
  Fly   199 DYKTLSNSKCKETM---TQLTDTEICALERFGKGACNGDSGGPLVM--KSGESYKQVGVVSYGTA 258

  Fly   253 PCGYANRPTVYTSVPPYIGWIHQ 275
            .|. :|.|.|||.|..:.|||.:
  Fly   259 FCA-SNNPDVYTRVSMFDGWIKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 78/251 (31%)
Tryp_SPc 41..273 CDD:214473 76/247 (31%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 76/248 (31%)
Tryp_SPc 47..280 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.