DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and KLK8

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:228 Identity:59/228 - (25%)
Similarity:92/228 - (40%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LCGASIIGKRWLLTAAHCV----------DELRTFNGDAVGTPVYAGIINRSNVTAAQVRYVDFA 123
            |||..::|..|:||||||.          ..|:..:|.....||...|                 
Human   102 LCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSI----------------- 149

  Fly   124 STHRSFNGNAGSD---NIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEY 185
             .|..:|.:...|   ::.||.:.:.....::|:.|:|.|.......|...: |||......:.:
Human   150 -PHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVS-GWGTVTSPRENF 212

  Fly   186 SKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS----QVKTCYGDGGTPLIYWPITGPAELVGL 246
            ...|..|...:.....|::..|..  :|...||:    ...||.||.|.||:.     ...|.|:
Human   213 PDTLNCAEVKIFPQKKCEDAYPGQ--ITDGMVCAGSSKGADTCQGDSGGPLVC-----DGALQGI 270

  Fly   247 GSWSYMPCGYANRPTVYTSVPPYIGWIHQTIGA 279
            .||...|||.:::|.|||::..|:.||.:.||:
Human   271 TSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 57/223 (26%)
Tryp_SPc 41..273 CDD:214473 55/220 (25%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 55/220 (25%)
Tryp_SPc 78..300 CDD:238113 57/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.