DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and LOC103908930

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:268 Identity:65/268 - (24%)
Similarity:99/268 - (36%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VHAEIQPL--IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNG 95
            |:....|:  ||.||:.. .::.|:.:.::.....:   ||||:|.:.|.::||||       |.
Zfish    11 VNVACSPVDKIIGGYECP-PNSQPWQIYITNDGQRW---CGASLINESWAVSAAHC-------NI 64

  Fly    96 DAVGTPVYAGIINRSNVTAAQVRY-VDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALP 159
            .|....||.|..|...|...:.|. .:....|..|...:..::|.|:.:.:...:|..||.|.|.
Zfish    65 GANLLTVYLGKHNIDVVEKTEQRIRTEKVFPHPEFKFPSEDNDIMLIKLKDPAVFNQYVQPIPLA 129

  Fly   160 DINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPA-DAPLTAQQVCSQV-- 221
             .:.....:.....|||.|:                    .|...:|.. |..:.::|.|.:|  
Zfish   130 -TSCSSEGEQCLVSGWGYTE--------------------VGLPSVLQCLDLAVQSRQECERVYK 173

  Fly   222 -----------------KTCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPY 269
                             ..|:||.|.||:.     ..||.|:.||. ..|.....|.||..|..|
Zfish   174 DKFTQNMLCAGFMEGGKGVCHGDSGGPLVC-----NGELRGVVSWG-AGCAEPGYPAVYVEVCRY 232

  Fly   270 IGWIHQTI 277
            ..||..||
Zfish   233 SDWIATTI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 61/255 (24%)
Tryp_SPc 41..273 CDD:214473 59/252 (23%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.