DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and si:ch73-182e20.4

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_009296334.2 Gene:si:ch73-182e20.4 / 100535157 ZFINID:ZDB-GENE-131127-155 Length:341 Species:Danio rerio


Alignment Length:267 Identity:72/267 - (26%)
Similarity:107/267 - (40%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EIQPLIIDGYD-VQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVG 99
            ::.|.|:.|.: .:|.  .|::|||   |....|:||.|:|...|:|||||||:..|:      .
Zfish    66 QLNPRIVGGLNSTEGA--WPWMVSL---RYYGNHICGGSLINNEWVLTAAHCVNLTRS------N 119

  Fly   100 TPVYAGIINRSNVTAAQV-RYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDIND 163
            ..||.|...|......:: |.|.....|.|:|.....::||||.:|.:..|:..::.:.|.|...
Zfish   120 MLVYLGKWRRYAADVNEITRTVSNIIPHPSYNSTTYDNDIALLQLSSTVHYSDYIKPVCLADEQS 184

  Fly   164 DYSNKTAA-AYGWGLTDPDGDEYSKELQYAFAPL-----LNSTGCKELLPAD------APLTAQQ 216
            ::...|.: |.|||.....|....:.......||     |.....|....||      ..:....
Zfish   185 NFPPGTRSWATGWGRIGVSGKGGIRGRTTVSVPLPPPGILQEVKLKVYSNADCNSICHGRINPNM 249

  Fly   217 VCSQVK-----TCYGDGGTPLI-----YWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIG 271
            :|:..:     |..||.|.||:     .|      ...|:.|..| .|...|.|.|:..|..|..
Zfish   250 ICAGTRSGGKATFSGDSGGPLVSKQCSVW------VQAGVVSHGY-GCAQPNLPEVFIRVSEYKQ 307

  Fly   272 WIHQTIG 278
            ||...:|
Zfish   308 WITAAVG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 70/258 (27%)
Tryp_SPc 41..273 CDD:214473 68/255 (27%)
si:ch73-182e20.4XP_009296334.2 Tryp_SPc 71..309 CDD:238113 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.