DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and tmprss6

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:246 Identity:58/246 - (23%)
Similarity:96/246 - (39%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTP----VYAGIINRSNVTA 114
            |:..||.:..   .|:||.:::..:|:||||||      |..::..:|    ||.|.:..|..|.
 Frog   583 PWQASLQVRG---EHICGGTLVADQWILTAAHC------FTPESYASPEVWTVYLGKVRLSRSTQ 638

  Fly   115 AQVRY-VDFASTHRSFNGNAGSDNIALLHVSESFEYNA-RVQQIALPDINDDY-SNKTAAAYGWG 176
            .::.: |.....|..::.::...::||:.:.......: .||.|.||.....: :..:....|||
 Frog   639 KELAFKVIRLVIHPFYDEDSHDYDVALVLLDHLVPLTSPHVQPICLPSSTHHFPTGSSCWVTGWG 703

  Fly   177 LTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQV-------------------K 222
            ....:|.. |..||                ..|..|.||.:|:::                   .
 Frog   704 SVKENGPT-SDVLQ----------------KVDIQLVAQDICTELYRYQISPRMLCAGYRDGSKD 751

  Fly   223 TCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
            .|.||.|:||:....:|.....||.||. ..||......||:.:...:.||
 Frog   752 ACQGDSGSPLVCKTASGRWFQAGLVSWG-AGCGIPRYFGVYSRITRLVQWI 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 58/246 (24%)
Tryp_SPc 41..273 CDD:214473 56/244 (23%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060
Tryp_SPc 572..804 CDD:238113 58/246 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.