DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and LOC100485347

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_002941066.3 Gene:LOC100485347 / 100485347 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:279 Identity:84/279 - (30%)
Similarity:115/279 - (41%) Gaps:51/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFLLPLLALAGAAKLPHIQHLTLRDTE-QVHAEIQPLIIDGYDVQGVDNVPYLVSLSLTRATY-- 66
            |.:||||             |.||.:| |.|.     ||.|.:.     ||:  |.....|.|  
 Frog     4 LLVLPLL-------------LLLRGSEAQTHR-----IIGGEEC-----VPH--SQPWQVALYYF 43

  Fly    67 -THLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTA-AQVRYVDFASTHRSF 129
             ..:||..:|.:.|:||||||         :.....|..|..||::.|. .|..|......|:.|
 Frog    44 SDFICGGVLINEWWVLTAAHC---------NQSNLQVLLGAHNRTSPTGDEQYTYAAKICPHQDF 99

  Fly   130 NGNAGSDNIALLHVSESFEYNARVQQIALPD-INDDYSNKTAAAYGWGLTDPDGDEYSKELQYAF 193
            ......::|.||.::...:.|..|..|.|.. :.||  |....|.|||.|....:.|..|||...
 Frog   100 EPVTYDNDIMLLKLASEADINTWVAPIPLASYLVDD--NSECLASGWGSTTSPEETYPGELQCVN 162

  Fly   194 APLLNSTGCKELLPADA----PLTAQQVCSQVKTCYGDGGTPLIYWPITGPAELVGLGSWSYMPC 254
            ...::::.|::..|.|.    .|.|..|.....||.||.|.||:.     ..||.|:.||..:.|
 Frog   163 ITTVSNSDCQDYYPRDTITDNMLCAGDVAGGKDTCGGDSGGPLVC-----NEELHGITSWGDLVC 222

  Fly   255 GYANRPTVYTSVPPYIGWI 273
            |..::|.|:..|..||.||
 Frog   223 GSPDKPGVFAKVSNYIDWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 73/242 (30%)
Tryp_SPc 41..273 CDD:214473 71/240 (30%)
LOC100485347XP_002941066.3 Tryp_SPc 23..244 CDD:238113 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.