DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33127 and tmprss11f

DIOPT Version :9

Sequence 1:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:240 Identity:69/240 - (28%)
Similarity:114/240 - (47%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAG 105
            |:.|.:. |:.:.|:..||   |...:|.||||::...||:.||||.|    .|.||....|..|
 Frog   197 IVGGTNA-GLGSWPWQASL---RLLGSHTCGASLLNDTWLVAAAHCFD----MNADANSWTVVLG 253

  Fly   106 IINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTA 170
            .||..:.:..::..:.....:.|.|..   ::||||.:.....:.:.::.:.||:.:|.:.:.::
 Frog   254 TINVYSGSEFKIEKIIIYEGYTSHNHR---NDIALLKLFTPLNFTSIIRPVCLPEASDIFPDGSS 315

  Fly   171 A-AYGWG-LTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS-----QVKTCYGDG 228
            . ..||| ||  ||...|:.||.|...::||..|.........:....:|:     |:.:|.||.
 Frog   316 CYITGWGALT--DGGSASQVLQQAEVKIINSDTCSSSQMYGGLIYPSMICAGYATGQIDSCQGDS 378

  Fly   229 GTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273
            |.||:... :|...|:|:.|:.| .|...|:|.||:.:.....||
 Frog   379 GGPLVTLK-SGRWVLIGIVSFGY-GCALPNKPGVYSRITYLRNWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 69/240 (29%)
Tryp_SPc 41..273 CDD:214473 67/238 (28%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 67/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.