DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and ERP6

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_011513.1 Gene:ERP6 / 852882 SGDID:S000002970 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:63/210 - (30%)
Similarity:110/210 - (52%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRDQFISLALILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGF-MPSSP 64
            |...:|.||.:|.... ....||:....:||||::|:..:|.:..:|.:|:||.:...: :||..
Yeast     1 MLSHYIFLAFVLLPFR-VSAFYFYGYGGDRKCFLKELSKDTLLKGSYNLEVYDDKLADYALPSYN 64

  Fly    65 GIGMHV---EVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQV 126
            ..|:.:   ||.|::.::| .:..|..|..||.:...||:.||:.|....|....:.::.::.:|
Yeast    65 DYGIVIDVEEVFDNNHRVV-HQQGSPSGDFSFLALESGEYKICLQSRVNNWVGKTKTKLEIEFEV 128

  Fly   127 GEHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQ 191
            |..|:  ..:.:||.|..|..::..|..::..|.:||...|.|||.||..|||.|||.:||::.|
Yeast   129 GFEAM--LDMQRKETLESLHGKVSILNSKIVDIRREQQLMREREESFRDISESVNSRAMWWTVTQ 191

  Fly   192 TVVLVCMGFWHLFNL 206
            ..:|:.:..|.:.:|
Yeast   192 VTLLIIICVWQMKSL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 57/189 (30%)
ERP6NP_011513.1 EMP24_GP25L 19..210 CDD:395878 58/191 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344506
Domainoid 1 1.000 111 1.000 Domainoid score I1373
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5308
Inparanoid 1 1.050 115 1.000 Inparanoid score I1337
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 1 1.000 - - mtm9154
orthoMCL 1 0.900 - - OOG6_102210
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.