DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and p24delta5

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_173608.1 Gene:p24delta5 / 838792 AraportID:AT1G21900 Length:216 Species:Arabidopsis thaliana


Alignment Length:213 Identity:58/213 - (27%)
Similarity:104/213 - (48%) Gaps:22/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FISLALILCVLHSACGLYFHISQT-ERKCFIEEVPDETTVIVN-YKVELYDPRSNGFMPS---SP 64
            |:::.|....::....::..|..| ..||..||:.....|:.: |.|:.::|.:...:.|   ||
plant    12 FLTVVLFFLTVNYGEAIWLTIPTTGGTKCVSEEIQSNVVVLADYYVVDEHNPENTPAVSSKVTSP 76

  Fly    65 -GIGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGE 128
             |..:|.:..            .:.|:.:||:...|.::.|.:.:|:...:. .:.:.:|.::|.
plant    77 YGNNLHHQEN------------VTHGQFAFTTQEAGNYLACFWIDSSHHLAN-PITLGVDWKMGI 128

  Fly   129 HAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWW---SLA 190
            .|.|:..||:|||:..::|::|:|...|..|.:..||.:.||...|..||:|||||.|:   ||.
plant   129 AAKDWDSVAKKEKIEGVELQLRRLEGLVLSIRENLNYIKDREAEMREVSETTNSRVAWFSIMSLG 193

  Fly   191 QTVVLVCMGFWHLFNLFH 208
            ..||:|.....:|...||
plant   194 VCVVVVGSQILYLKRYFH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 54/194 (28%)
p24delta5NP_173608.1 EMP24_GP25L 27..210 CDD:279450 54/195 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1093
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.