DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and AT1G14010

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_172854.1 Gene:AT1G14010 / 837961 AraportID:AT1G14010 Length:212 Species:Arabidopsis thaliana


Alignment Length:216 Identity:53/216 - (24%)
Similarity:91/216 - (42%) Gaps:38/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHS-ACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHV--- 70
            |||.:|.. ...:.:.:.....||..||:......|..|.:  .:|..:..:|||..:.:.|   
plant    11 LILSILSPVTLSIRYELLSGHTKCISEEIHANAMTIGKYSI--INPHEDHPLPSSHKVTVRVTSP 73

  Fly    71 ---EVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQ------LRVHLDIQV 126
               ...:||.        ...|:.||.:...|:::.|        ||...      |.:..|.:.
plant    74 QGTAYHESDG--------VESGQFSFVAVETGDYISC--------FSAVDHKPETTLIIDFDWRT 122

  Fly   127 GEHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQ 191
            |.|..|:::||:|.::..::..:::|.:.|..|..|..|.|.|||...:.:.:|||::.|.|...
plant   123 GIHTKDWSNVAKKSQVETMEFEVKKLFETVNGIHDEMFYLRDREEEMHNLNIATNSKMAWLSFVS 187

  Fly   192 TVVLVCMG-----FWHLFNLF 207
              :.||:.     ||||...|
plant   188 --LAVCLSVAGLQFWHLKTFF 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 48/202 (24%)
AT1G14010NP_172854.1 EMP24_GP25L 22..207 CDD:395878 49/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1093
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.