DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and AT3G29070

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_189550.2 Gene:AT3G29070 / 822551 AraportID:AT3G29070 Length:225 Species:Arabidopsis thaliana


Alignment Length:200 Identity:45/200 - (22%)
Similarity:85/200 - (42%) Gaps:12/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRD 74
            :::.|:.....:...:.....||..:::......:..|.:  .:|.....:|  |...:.|.|..
plant    25 MMMMVMRRGESMRLDMESGNTKCISDDIKTNYMTVGTYSI--VNPNEGHHLP--PSHKLFVTVSS 85

  Fly    75 SDDKIVLSRVYSSQGRISFTSHTPGEHVICMFS---NSTAWFSGAQLRVHLDIQVGEHAIDYAHV 136
            ...|..........|:..||:...|:::.|..:   ..||.|:     |..:.:.|..|.|:..:
plant    86 PKGKSHHHAENVESGKFVFTAEETGDYMTCFVAPGYRPTAKFA-----VDFEWKSGVEAKDWTTI 145

  Fly   137 AQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFW 201
            |::.::|.|::.:|:|||..|.|.:|......||...:..:.|||||:...||...||.:.:...
plant   146 AKRGQITMLEVEVRKLLDVTETIHEEMFQLIEREREMQELNRSTNSRMAALSLLSFVVTMSVAGL 210

  Fly   202 HLFNL 206
            .|.:|
plant   211 QLRHL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 43/188 (23%)
AT3G29070NP_189550.2 EMP24_GP25L 35..220 CDD:279450 43/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1093
orthoMCL 1 0.900 - - OOG6_102210
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.