DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and Tmed11

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_001071744.1 Gene:Tmed11 / 689712 RGDID:1588776 Length:214 Species:Rattus norvegicus


Alignment Length:204 Identity:91/204 - (44%)
Similarity:139/204 - (68%) Gaps:7/204 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHS-ACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVR 73
            ::||...| :...|||..:.|.||.||::|.:|.:...:|::.:|...:.|:.|:||:||.|.|.
  Rat     6 ILLCFSFSFSAAFYFHAGEREEKCIIEDIPSDTLITGTFKIQQWDIGRHDFLESAPGLGMFVTVT 70

  Fly    74 DSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYAHV 136
            ::|: ::||::|.:||...||||:.|||:||:.||||.:  |.|::||:||||:||||.:|...|
  Rat    71 NNDE-VLLSKLYGAQGTFYFTSHSSGEHIICLESNSTQFVSFGGSKLRIHLDIRVGEHDLDAVIV 134

  Fly   137 AQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFW 201
            ..|:|:.|:...:|.|::|:|||.|||:|||.|||.||.|||.||..||||:.||.::.:.:|.:
  Rat   135 QAKDKVNEVAFTLRHLIEQIEQILKEQDYQRDREENFRITSEDTNRNVLWWAFAQILIFISVGIF 199

  Fly   202 ---HLFNLF 207
               ||.:.|
  Rat   200 QMKHLKDFF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 87/190 (46%)
Tmed11XP_001071744.1 EMP24_GP25L 17..208 CDD:395878 87/191 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.