DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and Tmed10

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_081051.1 Gene:Tmed10 / 68581 MGIID:1915831 Length:219 Species:Mus musculus


Alignment Length:199 Identity:63/199 - (31%)
Similarity:105/199 - (52%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEV 72
            |.|:|....|..|:.||:....|||..||:..:..|...|::   ..:|.|    :.|:..|:::
Mouse    19 LFLLLLGPSSVLGISFHLPVNSRKCLREEIHKDLLVTGAYEI---TDQSGG----AGGLRTHLKI 76

  Fly    73 RDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYAHVA 137
            .||...|:.::..:::|:.:||:.......:|..|..|..... || |.||::.|..|.:|..:|
Mouse    77 TDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPD-QL-VILDMKHGVEAKNYEEIA 139

  Fly   138 QKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWH 202
            :.|||..|::.:|:|.|..|.|..:..|.:.|||..|.|:||||:|||::|:.....|:.:..|.
Mouse   140 KVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQ 204

  Fly   203 LFNL 206
            :|.|
Mouse   205 VFYL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 58/185 (31%)
Tmed10NP_081051.1 Required for interaction with STX17. /evidence=ECO:0000250 1..142 36/131 (27%)
EMP24_GP25L 31..213 CDD:279450 59/187 (32%)
Required for TMED10 and TMED2 cis-Golgi network localization. /evidence=ECO:0000250 147..178 11/30 (37%)
Interaction with COPG1. /evidence=ECO:0000250 204..219 2/5 (40%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000250|UniProtKB:P49755 207..219 1/2 (50%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..219
COPII vesicle coat-binding. /evidence=ECO:0000255 211..212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.