DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and tmed10

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001016258.1 Gene:tmed10 / 549012 XenbaseID:XB-GENE-968508 Length:207 Species:Xenopus tropicalis


Alignment Length:209 Identity:63/209 - (30%)
Similarity:104/209 - (49%) Gaps:23/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALILCVLHSA--CG----LYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGI 66
            :|.:|.||.:.  ||    :.|.:....|||..||:  ...|:|..:.||.:..:.|        
 Frog     1 MARLLPVLFALLFCGYVQPISFSLPPNSRKCLREEI--HKNVLVTGEYELSEAHNQG-------- 55

  Fly    67 GMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGA----QLRVHLDIQVG 127
            .:.:::.||...|:.|:..:|:|:.:||:.......:|..|...|   ||    ...|:|.::.|
 Frog    56 QVRLKITDSAGHILYSKEDASKGKFAFTTEEYDMFEVCFDSKLPA---GAGRVPDQMVNLIMKHG 117

  Fly   128 EHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQT 192
            ..|.:|..:|:.|||..|::.:|:|.|..|.|..:..|.:.|||..|.|:||||.|||::|:...
 Frog   118 VEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNVRVLYFSIFSM 182

  Fly   193 VVLVCMGFWHLFNL 206
            ..|:.:..|.:|.|
 Frog   183 CCLMGLATWQVFYL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 57/193 (30%)
tmed10NP_001016258.1 EMP24_GP25L 19..201 CDD:366467 57/191 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.