DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and tmed4

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001015779.1 Gene:tmed4 / 548496 XenbaseID:XB-GENE-941602 Length:214 Species:Xenopus tropicalis


Alignment Length:205 Identity:134/205 - (65%)
Similarity:166/205 - (80%) Gaps:7/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHSAC--GLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEV 72
            |:|.:|....  ||||||.:||::|||||:||||.||.|||.:|:|.:|..|:||:||:||||||
 Frog     4 LLLGILQFGLSRGLYFHIGETEKRCFIEEIPDETMVIGNYKTQLWDKQSETFLPSTPGLGMHVEV 68

  Fly    73 RDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNST--AWFSGAQLRVHLDIQVGEHAIDYAH 135
            :|||.|::|||.|.|:||.:|||||||||.||:.||||  ::|:|.:||||||||:|||..:|..
 Frog    69 KDSDGKVILSRQYGSEGRFTFTSHTPGEHQICLHSNSTRMSFFAGGKLRVHLDIQIGEHTNNYPE 133

  Fly   136 VAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGF 200
            :|.|:||||||||:||||||||||.||||||||||||||.||||||.||||||:|||::|:..|.
 Frog   134 IAAKDKLTELQLRVRQLLDQVEQIQKEQNYQRYREERFRLTSESTNQRVLWWSIAQTLILILTGI 198

  Fly   201 W---HLFNLF 207
            |   ||.:.|
 Frog   199 WQMRHLKSFF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 130/190 (68%)
tmed4NP_001015779.1 EMP24_GP25L 16..209 CDD:307313 131/193 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 283 1.000 Domainoid score I1617
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5308
Inparanoid 1 1.050 294 1.000 Inparanoid score I2697
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 1 1.000 - - mtm9320
Panther 1 1.100 - - O PTHR22811
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.150

Return to query results.
Submit another query.