DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and tmed9

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001011147.1 Gene:tmed9 / 496564 XenbaseID:XB-GENE-944838 Length:217 Species:Xenopus tropicalis


Alignment Length:201 Identity:124/201 - (61%)
Similarity:159/201 - (79%) Gaps:2/201 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEV 72
            |.|:......|..|||||.:||:||||||:||||.|:.||:.:::|.:...::|::||:||.|||
 Frog     7 LLLLAACFGPAFSLYFHIGETEKKCFIEEIPDETMVVGNYRTQMFDKQREDYLPATPGLGMFVEV 71

  Fly    73 RDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNST--AWFSGAQLRVHLDIQVGEHAIDYAH 135
            :|.|||::|||.|.|:||.:|||||||||.||:.||||  |.|:|..|||||||||||||.||..
 Frog    72 KDPDDKVILSRQYGSEGRFTFTSHTPGEHQICLHSNSTKFALFAGGMLRVHLDIQVGEHANDYVD 136

  Fly   136 VAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGF 200
            :|.|:||..||||:|||::|||||.|||||||:||||||.|||||:.||||||:|||::||.:|.
 Frog   137 IAAKDKLNTLQLRVRQLIEQVEQIQKEQNYQRWREERFRQTSESTSQRVLWWSIAQTLILVTIGV 201

  Fly   201 WHLFNL 206
            |.:.:|
 Frog   202 WQMKHL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 120/187 (64%)
tmed9NP_001011147.1 EMP24_GP25L 19..212 CDD:366467 121/189 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 283 1.000 Domainoid score I1617
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 294 1.000 Inparanoid score I2697
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 1 1.000 - - mtm9320
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.