DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and bai

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster


Alignment Length:203 Identity:54/203 - (26%)
Similarity:91/203 - (44%) Gaps:17/203 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALILCVLHSAC-----GLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGM 68
            |.|:|:| .||     .:.|.:|...:||..|::.....|:..::|.           ..||..:
  Fly     5 AFIVCLL-MACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVS-----------DVPGQII 57

  Fly    69 HVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDY 133
            ....||:...|:..:.:.::|:.||.|.....:.||..|...|...|....|.|..:.|.....|
  Fly    58 DYIARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSY 122

  Fly   134 AHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCM 198
            ..:.:..||..|::.:::|.|..:.|.::....|.|||..|.|:|.||||||::|:.....|:.:
  Fly   123 EGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGL 187

  Fly   199 GFWHLFNL 206
            ..|.:..|
  Fly   188 ATWQVLYL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 47/185 (25%)
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 48/187 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2831
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
54.940

Return to query results.
Submit another query.