DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and tmed4

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001002134.1 Gene:tmed4 / 415224 ZFINID:ZDB-GENE-040625-140 Length:220 Species:Danio rerio


Alignment Length:211 Identity:132/211 - (62%)
Similarity:162/211 - (76%) Gaps:13/211 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCV--------LHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGI 66
            |:.||        |..:..|||||.:||:||||||:||||.||..|:.:|:|.::..|:||:||:
Zfish     4 LVSCVGFLLLFVWLSPSQALYFHIGETEKKCFIEEIPDETMVIGRYRTQLWDKQAGSFLPSTPGL 68

  Fly    67 GMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNST--AWFSGAQLRVHLDIQVGEH 129
            |||||::|.:.|::|||.|.|.||.:|||||||||.||:.||||  |.|:|.:||||||||||||
Zfish    69 GMHVEIKDPETKVILSRQYGSDGRFTFTSHTPGEHQICLHSNSTKMALFAGGKLRVHLDIQVGEH 133

  Fly   130 AIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVV 194
            ..:|..:|.|:||||||||:||||||||||.||||||||||||||.||||||.||||||:||||:
Zfish   134 TNNYPEIAAKDKLTELQLRVRQLLDQVEQIQKEQNYQRYREERFRMTSESTNQRVLWWSIAQTVI 198

  Fly   195 LVCMGFW---HLFNLF 207
            |:..|.|   ||.:.|
Zfish   199 LIITGIWQMKHLKSFF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 127/190 (67%)
tmed4NP_001002134.1 EMP24_GP25L 22..215 CDD:279450 128/193 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574548
Domainoid 1 1.000 291 1.000 Domainoid score I1497
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5308
Inparanoid 1 1.050 301 1.000 Inparanoid score I2657
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 1 1.000 - - mtm6359
orthoMCL 1 0.900 - - OOG6_102210
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.