DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and loj

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster


Alignment Length:225 Identity:47/225 - (20%)
Similarity:85/225 - (37%) Gaps:48/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RDQF---ISLALILCVL-------------------HSACGLYFHISQTERKCFIEEVPDETTVI 44
            |||.   :.:|||.|.|                   ..|.....||...:..|:.:.|....|..
  Fly     7 RDQINLVLPIALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFY 71

  Fly    45 VNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGRISFTSH-TPGEHVICMFSN 108
            |::.|........||           .||:...::|  :.|..|....:|.. :||.:......|
  Fly    72 VSFSVVRGGDGMAGF-----------AVRNPAGEVV--KPYQWQATADYTDQVSPGGYYSVCIDN 123

  Fly   109 STAWFSGAQLRVHLDIQVGEHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQN----YQ--- 166
            ..:.|:|..:.:::.:...:....||     :::.:|||.::.....|..:.:..|    ||   
  Fly   124 QFSRFAGKLVNIYITVVKYDAWDKYA-----KEIEQLQLNMQNFTATVGTVERNINDMMGYQAHS 183

  Fly   167 RYREERFRHTSESTNSRVLWWSLAQTVVLV 196
            |:||.|........|:.:..:|::|.||::
  Fly   184 RHRESRDYALLLDNNAYIQTFSISQIVVIL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 38/185 (21%)
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 38/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.