DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and Tmed9

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001009703.1 Gene:Tmed9 / 361207 RGDID:1307627 Length:235 Species:Rattus norvegicus


Alignment Length:203 Identity:128/203 - (63%)
Similarity:162/203 - (79%) Gaps:5/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRD 74
            |:||:......|||||.:||:||||||:||||.||.||:.:|||.:...:.|::||:||.|||:|
  Rat    27 LLLCLAARGGALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKD 91

  Fly    75 SDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYAHVA 137
            .:||::|:|.|.|:||.:|||||||||.||:.||||.:  |:|..|||||||||||||.|||.:|
  Rat    92 PEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIA 156

  Fly   138 QKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFW- 201
            .|:||:|||||:|||::|||||.|||||||:||||||.||||||.||||||:.||::||.:|.| 
  Rat   157 AKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQ 221

  Fly   202 --HLFNLF 207
              ||.:.|
  Rat   222 MRHLKSFF 229

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 124/190 (65%)
Tmed9NP_001009703.1 EMP24_GP25L 37..230 CDD:395878 125/193 (65%)
Required for interaction with STX17. /evidence=ECO:0000250 121..160 25/38 (66%)
COPI vesicle coat-binding. /evidence=ECO:0000255 228..235 1/2 (50%)