DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and tmed-10

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_505879.1 Gene:tmed-10 / 179567 WormBaseID:WBGene00009829 Length:204 Species:Caenorhabditis elegans


Alignment Length:204 Identity:60/204 - (29%)
Similarity:98/204 - (48%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLALILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGM--H 69
            ||.:.|..:..|..|.|::...|:||..||:.....|...|:.             |.||..  .
 Worm     3 SLVIFLSAIVLAHSLRFYVPPKEKKCLKEEIHKNVVVTGEYEF-------------SQGIQYTGS 54

  Fly    70 VEVRDSDDKIVLSR--VYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAID 132
            :.|.|:....:..|  ....:|:.:||:.......||:.::..|...|.:..|.|.::.|..|.:
 Worm    55 IHVTDTRGHTLYKRENFADLKGKFAFTADEYDIFEICIENHPPAGHPGEKREVSLILKHGVEAKN 119

  Fly   133 YAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVC 197
            |..:|:.|||..|::.:|:|.|..:.|||:..:.|.|||..|:|:||||||||:.|:...:.|:.
 Worm   120 YDDIAKAEKLKPLEVELRRLEDMADSITKDFAFMRQREEEMRNTNESTNSRVLYLSIFSMLCLLG 184

  Fly   198 MGFWHLFNL 206
            :..|.:..|
 Worm   185 LAIWQVLFL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 55/189 (29%)
tmed-10NP_505879.1 EMP24_GP25L 16..198 CDD:366467 56/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.