Sequence 1: | NP_001189205.1 | Gene: | p24-2 / 318890 | FlyBaseID: | FBgn0053105 | Length: | 244 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006818.3 | Gene: | TMED10 / 10972 | HGNCID: | 16998 | Length: | 219 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 64/202 - (31%) |
---|---|---|---|
Similarity: | 105/202 - (51%) | Gaps: | 12/202 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LALILCVL---HSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMH 69
Fly 70 VEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYA 134
Fly 135 HVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMG 199
Fly 200 FWHLFNL 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
p24-2 | NP_001189205.1 | EMP24_GP25L | 20..206 | CDD:279450 | 58/185 (31%) |
TMED10 | NP_006818.3 | Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 | 1..142 | 37/134 (28%) | |
EMP24_GP25L | 31..213 | CDD:395878 | 59/187 (32%) | ||
Required for TMED10 and TMED2 cis-Golgi network localization | 147..178 | 11/30 (37%) | |||
Interaction with COPG1 | 204..219 | 2/5 (40%) | |||
Interaction with ARF1 and IL1B. /evidence=ECO:0000269|PubMed:11726511, ECO:0000269|PubMed:32272059 | 207..219 | 1/2 (50%) | |||
COPI vesicle coat-binding | 211..219 | ||||
COPII vesicle coat-binding | 211..212 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53581 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X178 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |