DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and TMED10

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_006818.3 Gene:TMED10 / 10972 HGNCID:16998 Length:219 Species:Homo sapiens


Alignment Length:202 Identity:64/202 - (31%)
Similarity:105/202 - (51%) Gaps:12/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALILCVL---HSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMH 69
            |||:|..|   .....:.||:....|||..||:..:..|...|::   ..:|.|    :.|:..|
Human    16 LALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEI---SDQSGG----AGGLRSH 73

  Fly    70 VEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYA 134
            :::.||...|:.|:..:::|:.:||:.......:|..|..|..... || |.||::.|..|.:|.
Human    74 LKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPD-QL-VILDMKHGVEAKNYE 136

  Fly   135 HVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMG 199
            .:|:.|||..|::.:|:|.|..|.|..:..|.:.|||..|.|:||||:|||::|:.....|:.:.
Human   137 EIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLA 201

  Fly   200 FWHLFNL 206
            .|.:|.|
Human   202 TWQVFYL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 58/185 (31%)
TMED10NP_006818.3 Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 1..142 37/134 (28%)
EMP24_GP25L 31..213 CDD:395878 59/187 (32%)
Required for TMED10 and TMED2 cis-Golgi network localization 147..178 11/30 (37%)
Interaction with COPG1 204..219 2/5 (40%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000269|PubMed:11726511, ECO:0000269|PubMed:32272059 207..219 1/2 (50%)
COPI vesicle coat-binding 211..219
COPII vesicle coat-binding 211..212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.