DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and si:ch211-255i20.3

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_003199913.2 Gene:si:ch211-255i20.3 / 100535182 ZFINID:ZDB-GENE-141216-113 Length:220 Species:Danio rerio


Alignment Length:191 Identity:76/191 - (39%)
Similarity:123/191 - (64%) Gaps:5/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLS 82
            |..:||.:.:.|.||.|||:|.:|.|...:::|.:|.....   ::|.:|:.|.|||...::||.
Zfish    23 ASAMYFDLGEQEEKCIIEEIPVDTLVTGVFRLEYWDENKKS---NTPQLGLTVTVRDPQHEVVLL 84

  Fly    83 RVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYAHVAQKEKLTEL 145
            :.:...|:.:|||...|:|.:||.||||.:  |:|.:|:||||:|:|||.||......|:.:..:
Zfish    85 KRFGRYGKFTFTSPASGQHFLCMQSNSTRFSVFAGDRLKVHLDVQMGEHTIDPNAAKTKDTIKAM 149

  Fly   146 QLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWHLFNL 206
            :..::.|:||:..|:::|::||.|||:||..||.||..||||::.||.:|:.:|||.:.||
Zfish   150 EYNLQHLIDQMRYISRQQDFQREREEKFRQMSEETNGNVLWWAIIQTSILLSVGFWQMKNL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 73/187 (39%)
si:ch211-255i20.3XP_003199913.2 EMP24_GP25L 25..214 CDD:279450 75/189 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.