DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-2 and gp25l

DIOPT Version :9

Sequence 1:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_002937324.3 Gene:gp25l / 100489853 XenbaseID:XB-GENE-955109 Length:218 Species:Xenopus tropicalis


Alignment Length:191 Identity:82/191 - (42%)
Similarity:126/191 - (65%) Gaps:4/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKI 79
            |.||  :|||:::.|.||.||::|.||.|...||::.:|.:.:.|:||:||:||.|.|...:.::
 Frog    17 LSSA--MYFHVAEKEEKCLIEDLPSETLVTGRYKIQKWDLKEHDFLPSAPGLGMVVTVTAPNGEV 79

  Fly    80 VLSRVYSSQGRISFTSHTPGEHVICMFSNST--AWFSGAQLRVHLDIQVGEHAIDYAHVAQKEKL 142
            :||::|...|:.:||||:||||.||:.||||  ..|...:||:|.|||.||:.:|:..:..|:|:
 Frog    80 LLSKLYGPDGKFTFTSHSPGEHTICLQSNSTNLIAFVSNKLRIHFDIQSGENPLDFHIINAKDKV 144

  Fly   143 TELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWHL 203
            .|:...:..|..::..|.|:|.|||.|||.:|..||.||:.||||::.||.:|..:|.|.:
 Frog   145 KEVTYGLEHLRGEINHIIKQQEYQREREEHYRGKSEETNNNVLWWAIIQTAILTSVGIWQI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 79/186 (42%)
gp25lXP_002937324.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.