DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31687 and CDC27

DIOPT Version :10

Sequence 1:NP_001163022.1 Gene:CG31687 / 318886 FlyBaseID:FBgn0051687 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001107563.1 Gene:CDC27 / 996 HGNCID:1728 Length:830 Species:Homo sapiens


Alignment Length:243 Identity:49/243 - (20%)
Similarity:103/243 - (42%) Gaps:61/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RRLDSTTDQANLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVV------LKALNLNQAAE 176
            |:..|.|::..:.:|| :.|..::          ::||. .|...|.:      ::|.||.:||.
Human   413 RKTKSKTNKGGITQPN-INDSLEI----------TKLDS-SIISEGKISTITPQIQAFNLQKAAA 465

  Fly   177 QMLVQAIRLVPMLWSAYLELSPLIMEKKKLLSLQLGGHWMRHFFMAHTYLEL--YLNDDGLKIYE 239
            :.|:..:|                                   .|...||.|  |...:.:.|..
Human   466 EGLMSLLR-----------------------------------EMGKGYLALCSYNCKEAINILS 495

  Fly   240 DLQASGFSKSIYLIAQMALVYHNKRDVDKAIELYQAL--LESASPYRLDNVDTYSNLLFVKEMKT 302
            .|.:..::.. :::.|:...|....:..:|..::..:  :|:   ||::.::.||..|:..:...
Human   496 HLPSHHYNTG-WVLCQIGRAYFELSEYMQAERIFSEVRRIEN---YRVEGMEIYSTTLWHLQKDV 556

  Fly   303 EMAQLAHKAVSINKYRPETCCVIGNYYSIRCDHQVAISYFQRALKLNP 350
            .::.|:.....::|..||..|..||.:|::.:|.:||.:||||::::|
Human   557 ALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDP 604

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity