DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and NUC1

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_012327.1 Gene:NUC1 / 853222 SGDID:S000003744 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:66/254 - (25%)
Similarity:112/254 - (44%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RPDNS----EFDVDTDDCHKLGGIMKYGFPS-TNDITINETFDFVTSFDRRNSAILWMCERV--- 117
            :|:::    .|:||.      .|..|||||. .:|:...|  :|::.::|:.....|:.|.:   
Yeast    42 KPNSNIQSHSFNVDP------SGFFKYGFPGPIHDLQNRE--EFISCYNRQTQNPYWVLEHITPE 98

  Fly   118 -------DLSN---------------------RVVYGDSTSVAPA--GAFGQSEAARVFFLSNIR 152
                   |..|                     |..| |....|||  ..|.|......|:|||:.
Yeast    99 SLAARNADRKNSFFKEDEVIPEKFRGKLRDYFRSGY-DRGHQAPAADAKFSQQAMDDTFYLSNMC 162

  Fly   153 PFLNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLP-RELKSNSWFLEFQ-SEERTMVAVPT 215
            |.:..|||...|..|..:...:::::.:|...||.:||| ::...|.:.:.:: ......:||||
Yeast   163 PQVGEGFNRDYWAHLEYFCRGLTKKYKSVRIVTGPLYLPKKDPIDNKFRVNYEVIGNPPSIAVPT 227

  Fly   216 HFFKILVIDKKFAG---DTIPYAEAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFE 271
            ||||::|.:...|.   :.|..| |:|:||.|::|..:|......:..:|.:|||...:
Yeast   228 HFFKLIVAEAPTANPAREDIAVA-AFVLPNEPISNETKLTDFEVPIDALERSTGLELLQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 54/212 (25%)
NUC1NP_012327.1 NUC1 8..308 CDD:224777 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.