powered by:
Protein Alignment Tengl1 and si:ch211-133n4.4
DIOPT Version :9
Sequence 1: | NP_722780.1 |
Gene: | Tengl1 / 318883 |
FlyBaseID: | FBgn0051682 |
Length: | 319 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001070844.1 |
Gene: | si:ch211-133n4.4 / 559260 |
ZFINID: | ZDB-GENE-030131-898 |
Length: | 266 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 20/75 - (26%) |
Similarity: | 32/75 - (42%) |
Gaps: | 14/75 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 PDNSEFDVDTDDCHKLGGIMKYGFPSTNDITINETFDFVTSFDRRNSAILWM---CERVDLSNRV 123
|.....|:|| .|..|..||.:...:||:.||...::|:....| | ::::|:|
Zfish 128 PSGHAVDLDT---------AKSTFTLTNAVPQEKTFNEVTWNQKKNNFKTHMDNNC--INVNNKV 181
Fly 124 VYGDSTSVAP 133
.....|.|.|
Zfish 182 EAYVVTGVIP 191
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D933605at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.