DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and Tengl4

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650038.2 Gene:Tengl4 / 41321 FlyBaseID:FBgn0037857 Length:378 Species:Drosophila melanogaster


Alignment Length:358 Identity:89/358 - (24%)
Similarity:148/358 - (41%) Gaps:103/358 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TAGSFFALGAYYQHIDVMRKIRRLEQRNPHAYFIRRKLYALLGIF-------------------- 58
            |..|.|.|||..|.....|:|:.:...:|:.|..|:.:|..|.:|                    
  Fly    13 TGASCFILGALVQQHLSFRQIKSVMLTDPYVYQCRQPIYRALSMFGHSSRKSITRTESNQTASIG 77

  Fly    59 -----------------------------------------AVRPDNSEFDVDTDDCHKLGGIMK 82
                                                     :|.|:.|..    ::...:..|||
  Fly    78 DESGTSKRYSERQDPGSVSIFEHFLLWGRRKAHNAISKMTLSVGPNGSRH----ENIEHVADIMK 138

  Fly    83 YGFPSTNDITINETFDFVTSFDRRNSAILWMCERVDLSNRVVYGDSTSVAPAGAFGQSEAARVFF 147
            ||||..::|.:.:  :||.|:||||....|:||.|. |..|...|..::....|:.........|
  Fly   139 YGFPGMDEIHVYK--NFVLSYDRRNRIAHWVCEHVK-SGCVQERDEKTLNKPNAYITDNTIPTIF 200

  Fly   148 LSNIRPF----------------------------------LNRGFNLTVWDRLLQYVHEMSQRH 178
            .:|:|.|                                  :|||....:|.||..||.:.:...
  Fly   201 SANMRDFKNSDWVGGHLASPQNYKCDALKFLEAYKFTNIVPINRGLKNHIWYRLESYVRDKAIEF 265

  Fly   179 GTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVMPNS 243
            .:|:.|||.:::|:.:...:|.:.:.......||||||||||::.:.:|..| :|..|.||:||:
  Fly   266 DSVHVYTGPLFMPQRITFRNWSVRYHVMGMNTVAVPTHFFKIIIREDEFNRD-MPIMEGYVVPNA 329

  Fly   244 PLNNNVELKTLLSDVREIENATGLRFFEGLDRN 276
            .::.:::|::.|:|||:||:..||:|.:|..|:
  Fly   330 YVDKDMDLRSFLADVRDIEHFAGLKFCDGQQRD 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 62/210 (30%)
Tengl4NP_650038.2 Endonuclease_NS 132..362 CDD:279553 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.