DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and CG14120

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster


Alignment Length:190 Identity:46/190 - (24%)
Similarity:77/190 - (40%) Gaps:53/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YGFPSTN--------DITINETFDFVTS--FDRRNSAILWMCERVDLSNRVVYGDSTSVAPAGAF 137
            ||....|        :||::|......|  |:...:..|   .|..||.:..:          .|
  Fly  1152 YGGKDVNTLYTQVQQNITVSEILGMDASPYFNTTGNVYL---ARGHLSAKTDF----------VF 1203

  Fly   138 GQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQYVHE-MSQRHGTVYAYTGS---IYLP------R 192
            |.::.|..||: |..|.. :.||...|:|:...|.: ::..:.||..|||:   ..||      |
  Fly  1204 GAAQKASFFFV-NAAPQW-QTFNGGNWERIEDSVRKFVADENITVDCYTGTWGVSTLPDVNGIGR 1266

  Fly   193 ELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKK------FAGDTIPYA------EAYVM 240
            ||     :|:|......::.||..:|:: :||::      ..|...|:|      |.|::
  Fly  1267 EL-----YLDFDENNNGLIPVPKLYFRV-IIDRESRNGIVLLGVNNPHATIEQIEEEYII 1320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 40/167 (24%)
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043 46/190 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.