DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and Endog

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog / 362100 RGDID:1310763 Length:294 Species:Rattus norvegicus


Alignment Length:299 Identity:81/299 - (27%)
Similarity:123/299 - (41%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GILATAGSFFALGAYYQHIDVMRKIRRLEQRNPHAYFIRRKLYALLGIFAVRPDNSEFDVDTDDC 74
            |:....|:  .|||..:|      .||.|.:.|          .|||...|.|      |...|.
  Rat     7 GLTLALGA--GLGAAAEH------WRRREGKGP----------GLLGRVPVLP------VVAADL 47

  Fly    75 HKL--------GGIMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCE-------RVDLSNRV- 123
            ..|        |.:.|||.|....:...|:  :|.|:|.|....||:.|       |.|...|. 
  Rat    48 PALPGGPAGSTGELAKYGLPGVAQLRSRES--YVLSYDPRTRGALWVLEQLRPERLRGDGDRRAC 110

  Fly   124 ---------VYGDSTSVAPAGA--------------FGQSEAARVFFLSNIRPFLNRGFNLTVWD 165
                     .|..:|:....|:              :.|......|:|||:.|.:.. .|...|:
  Rat   111 DFHEDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPH-LNQHAWN 174

  Fly   166 RLLQYVHEMSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGD 230
            .|.:|...:::.:..||..||.::|||.......::::|...:..|||||||||:|:::.  |..
  Rat   175 NLEKYSRSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEA--ASG 237

  Fly   231 TIPYAEAYVMPNSPLNNNVELKTLLSDVREIENATGLRF 269
            .|. ..:|||||:|::..:.|:..|..:..||.|:||.|
  Rat   238 QIE-LRSYVMPNAPVDETLPLERFLVPIESIERASGLLF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 57/203 (28%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 58/207 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.