DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and Tengl3

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_608660.3 Gene:Tengl3 / 33404 FlyBaseID:FBgn0051679 Length:337 Species:Drosophila melanogaster


Alignment Length:342 Identity:97/342 - (28%)
Similarity:160/342 - (46%) Gaps:64/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILATAG-SFFALGAYYQHIDVMRKIRRLEQRNPHAYFIRRKLYALLGIFAV--------RPDN-- 64
            :.|.|| :.|..||:.|....:|::.:..:|:|:.|..|.|||.:|..|..        ||.:  
  Fly    13 LCALAGVTGFVCGAFVQQEASIRQLLQQIRRDPYVYHHRHKLYPMLSTFGTDHEARLWNRPTSWA 77

  Fly    65 SEF---------DV---------DTDDCHKLGGIMKYGFPSTNDITINETFDFVTSFDRRNSAIL 111
            .:|         |:         |:.....|..::|||.|||.::.:::  |:|.|.|.|.:.:.
  Fly    78 DKFRELVLSPILDLVSATVTLKWDSATTTDLLDLVKYGLPSTENLYVHK--DYVVSQDLRTNGVR 140

  Fly   112 WMCERVDLSNRVVYGDSTSVAPAGAFGQSEAAR---VFFLSNIRPFLNRGFNLTVWDRLLQYVHE 173
            |:||.       ..||...|:..|....:...|   |:.||.....:.:.|...:|:.|..||..
  Fly   141 WICEH-------FRGDYQRVSSDGGGYSTMNLRYNDVYVLSCGSMSICKAFKRKIWNDLENYVSS 198

  Fly   174 MSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAY 238
            |::..|:||||||.||.|...:...|.::::..:...:.||:||||:|:::....|.. |:.||:
  Fly   199 MAKEFGSVYAYTGPIYTPTCYEIGKWTMKYEVFDWIPIPVPSHFFKVLIVESGVPGSQ-PFMEAF 262

  Fly   239 VMPNS-----PLNNNVELKTLLSDVREIENATGLRFFE--------GLDRNFVNTQASNSFVPSV 290
            ::.||     .||:: .:|     |.|||..|||||.:        |.|...|:|:|....:..:
  Fly   263 IIENSRRVGGKLNDH-RVK-----VGEIERYTGLRFNKIMQPVVQFGKDSFTVDTRAWAGRLEEI 321

  Fly   291 NGPLTNPLTLPMTNALD 307
            :.||   :|.|....|:
  Fly   322 SEPL---VTFPPDQKLN 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 59/192 (31%)
Tengl3NP_608660.3 Endonuclease_NS 125..294 CDD:214889 58/184 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.