DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and Tengl2

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster


Alignment Length:315 Identity:108/315 - (34%)
Similarity:168/315 - (53%) Gaps:49/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IIGILATAGSFFALGAYYQHIDVMRKIRRLEQRNPHAYFIRRKLYALLGIFAVRPDNSEFDVDTD 72
            ::|:.|...||.. |.|:||.|..:::|.|.|.:|:||::..|:|.:.         :.|:.:.:
  Fly    13 VLGVTALCASFVG-GMYFQHTDARKRLRELIQTDPYAYYLSPKIYEVF---------TFFESNNE 67

  Fly    73 DCHKLGGIMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCE---------------------- 115
            |.|::..|||:|||..:|:.:..  |||.|:||||....|:||                      
  Fly    68 DDHRMRQIMKFGFPGLDDLRLYS--DFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPD 130

  Fly   116 -------RVDLSNRVVYG-DSTSVAPAG--AFGQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQY 170
                   |.:||:....| |...:|.||  ...|:.....|||:||.|.:.:|||.:.|:.|.||
  Fly   131 LSVPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQY 195

  Fly   171 VHEMSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKF-AGDTIPY 234
            |..:..|.|:|:..||.:|.|.:.....|.:|::.....||||||||||:::::.|. .|.  ||
  Fly   196 VRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGK--PY 258

  Fly   235 AEAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFEGLDRN--FVNTQASNSFV 287
            .|.||:||:|:.:.:.|::.|.|:||||:..||:||:||.|:  |.:...|.|.|
  Fly   259 MEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGLKFFDGLRRSALFGSNYPSESRV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 76/209 (36%)
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 83/229 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.