DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and Exog

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006244150.2 Gene:Exog / 301062 RGDID:1304628 Length:443 Species:Rattus norvegicus


Alignment Length:230 Identity:60/230 - (26%)
Similarity:97/230 - (42%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KYGFPSTNDITINETFDFVTSFDRRNSAILWMCERVDLSNRVVYGDST----------------- 129
            ::|||.|...|...| :...|:|:......|:.|.:  |...:.||:.                 
  Rat   139 QFGFPLTGTETRRYT-NHALSYDQAKRVPRWVLEHI--SKDKIIGDADRKHCKFKPDPTVPSAFS 200

  Fly   130 --------------SVAPAG--AFGQSEAARVFFLSNIRP--FLNRGFNLTVWDRLLQYVHEMSQ 176
                          .:||||  .|.....|..|:||||.|  |.|   |...|:|:..|..|:::
  Rat   201 ALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFEN---NSGYWNRIEMYCRELTE 262

  Fly   177 RHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYA-EAYVM 240
            |...|:..:|.:.||......:..:.:|......||||:|.:|: ::.::....|.|.| .|:|:
  Rat   263 RFEDVWIVSGPLTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKV-ILARRSPESTEPLALGAFVV 326

  Fly   241 PNSPLNNNVELKTLLSDVREIENATGLRFFEGLDR 275
            ||..:....:|......:.::|..:||.||..|||
  Rat   327 PNKAIGFQSQLSEFQVSLHDLEKMSGLVFFPHLDR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 52/212 (25%)
ExogXP_006244150.2 NUC 152..361 CDD:214683 53/215 (25%)
Exog_C 377..425 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.