DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and Exog

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:229 Identity:58/229 - (25%)
Similarity:96/229 - (41%) Gaps:39/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KYGFPSTNDITINETFDFVTSFDRRNSAILWMCERVDLSNRVVYGDST----------------- 129
            ::|||.....|...| :...|:|:......|:.|.:  |...:.||:.                 
Mouse    64 QFGFPLAGTETRRYT-NHALSYDQAKRVPRWVLEHI--SKDKIIGDADRKHCKFKPDPSVPSAFS 125

  Fly   130 --------------SVAPAG--AFGQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQYVHEMSQRH 178
                          .:||||  .|.....|..|:||||.| .|...|...|:|:..|..|:::|.
Mouse   126 ALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVP-QNFDNNSGYWNRIEMYCRELTERF 189

  Fly   179 GTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYA-EAYVMPN 242
            ..|:..:|.:.||......:..:.:|......||||:|.:|: ::.::....|.|.| .|:|:||
Mouse   190 EDVWIVSGPLTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKV-ILARRSPESTEPLALGAFVVPN 253

  Fly   243 SPLNNNVELKTLLSDVREIENATGLRFFEGLDRN 276
            ..:....:|......:.::|..:||.||..|||:
Mouse   254 KAIGFQSQLSEFQVSLHDLEKMSGLVFFPRLDRS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 51/210 (24%)
ExogNP_766044.1 NUC 77..287 CDD:214683 53/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.