DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and ENDOG

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011516649.1 Gene:ENDOG / 2021 HGNCID:3346 Length:338 Species:Homo sapiens


Alignment Length:146 Identity:35/146 - (23%)
Similarity:56/146 - (38%) Gaps:34/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GGIMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCE-------RVDLSNRV----------VY 125
            |.:.|||.|....:...|:  :|..:|.|....||:.|       |.|...|.          .|
Human   151 GELAKYGLPGLAQLKSRES--YVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDSVHAY 213

  Fly   126 GDSTSVAPAGA--------------FGQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQYVHEMSQ 176
            ..:|:....|:              :.|......|:|||:.|.:.. .|...|:.|.:|...:::
Human   214 HRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPH-LNQNAWNNLEKYSRSLTR 277

  Fly   177 RHGTVYAYTGSIYLPR 192
            .:..||..||.::|||
Human   278 SYQNVYVCTGPLFLPR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 29/126 (23%)
ENDOGXP_011516649.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.