DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and LOC101885869

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_005159398.1 Gene:LOC101885869 / 101885869 -ID:- Length:368 Species:Danio rerio


Alignment Length:284 Identity:58/284 - (20%)
Similarity:103/284 - (36%) Gaps:70/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YFIRRKLYALLGIF--AVRPDNSEFDVDTDDCHKLGGIMKYG--FPSTNDITINETFDFVTSFDR 105
            :|:..|...:.||.  :|..||:.:.:   .|.:.....::.  :.:||.|.:...:.: |.|.:
Zfish   123 FFLEGKPPVIPGILKDSVSQDNNRYKL---ICQRYKNAYRFATLYDTTNKIPVFSAYRY-TGFKK 183

  Fly   106 RNSAILWMCE-------------RVDLSNRVVYG-----DSTSVAPAG-AFGQSEAARVFFLSNI 151
            ....|.||.|             ||:.:....|.     |...:.|.| |..:..|...|.|:|:
Zfish   184 GRPQIRWMIEPQLETSGVQMRARRVNQAYTEDYQKLYRLDRGHLFPNGHAANKDIAESTFTLTNV 248

  Fly   152 RPFLNRGFNLTVWDRLLQYVHEMSQ----RHGTVYAYTGSI-----YLPRELKSNSWFLEFQSEE 207
            .| ..:.||...|:|:...|.|:..    ::...|..||::     ||.::              
Zfish   249 VP-QYKSFNGGSWNRMENDVRELMDSDCAKNRPAYVLTGAVPNQEHYLNQK-------------- 298

  Fly   208 RTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFEG 272
               |.:|||.:.......|.....:  :.|:...|...:.:.:.|.....::|:     |:|.| 
Zfish   299 ---VNIPTHMWNAFCCYNKTKSTWV--SRAHWAANKDESEDKKKKIPEKTLKEL-----LQFLE- 352

  Fly   273 LDRNFVNTQASNSFVPSVNGPLTN 296
                    :..||.|...|..|.|
Zfish   353 --------EKYNSVVTLFNKCLYN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 41/204 (20%)
LOC101885869XP_005159398.1 Endonuclease_NS 158..328 CDD:214889 38/190 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.