DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and si:dkey-243k1.3

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001373225.1 Gene:si:dkey-243k1.3 / 100537487 ZFINID:ZDB-GENE-131121-191 Length:283 Species:Danio rerio


Alignment Length:287 Identity:57/287 - (19%)
Similarity:90/287 - (31%) Gaps:89/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LGIFAVRPDNSEFD--VDTDDCHKLGGIMKYGFPSTNDITIN---------ETFDFVTSFDRRN- 107
            :|:|....|....|  .|:.||.|.  ..|...|.......|         .|:.|.|.:|..: 
Zfish    11 IGLFLSPADGHVLDHFWDSPDCVKF--FYKEKIPDLGAFQPNLVRICQRFLNTYHFATLYDTYHR 73

  Fly   108 ----SAIL------------WMCE----------------RVDLSNRVVY--------------- 125
                ||.:            |..|                ::...|..:|               
Zfish    74 IAVYSAYIFEPSSGGGREKRWFVEPQLVSPAWSTEMEDGYKLSQQNPDIYLGEKQALNEDYTNSG 138

  Fly   126 GDSTSVAPAGAFGQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQYVHE-------MSQRHGTVYA 183
            .|...:.|.|..........|.|:|:.| .|...|...|::     ||       .:..| ..|.
Zfish   139 FDRGHLNPNGHHAVPSRNATFTLTNVVP-QNPTLNQNAWNK-----HESKLTSLFKANCH-QAYV 196

  Fly   184 YTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFF-KILVIDKKFAGDTIPYAEAYVMPNSPLNN 247
            ..|:|  |   .||:|.::...:.   |.:|.:.: ....||:.  |..|....|..: |:.||.
Zfish   197 LVGAI--P---SSNNWIIKNNVKR---VNIPEYLWDAFCCIDQN--GRPILSGAATAL-NTELNV 250

  Fly   248 NVE--LKTLLSDVREIENATGLRFFEG 272
            .||  |..::..:::..:|.....|.|
Zfish   251 VVERSLDEMVDFIQQFSDAPVNELFSG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 45/233 (19%)
si:dkey-243k1.3NP_001373225.1 Endonuclease_NS 62..263 CDD:214889 42/218 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.