DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and LOC100490758

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_002932761.1 Gene:LOC100490758 / 100490758 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:126 Identity:25/126 - (19%)
Similarity:42/126 - (33%) Gaps:40/126 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FFLSNIRPFLNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTM 210
            |.|:|..| :|...|...|:...:.:.|:::...|.|..||.:  |.....|.           .
 Frog   192 FTLTNAVP-MNSSLNQGQWNVYEKKMIEIARDCNTTYVVTGIV--PGNNSLND-----------R 242

  Fly   211 VAVPTHFFKILVIDKKFAGDTIPYAEAY---------VMPNSPLNNNVELKTLLSDVREIE 262
            |.:|:|.:                 .||         :...:.|.||:.....:..|.|:|
 Frog   243 VNIPSHVW-----------------SAYCCVDNNGKPIRSGAGLANNINYPVKVISVSELE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 25/126 (20%)
LOC100490758XP_002932761.1 Endonuclease_NS 79..295 CDD:214889 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.