DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl1 and exog

DIOPT Version :9

Sequence 1:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_031760009.1 Gene:exog / 100486077 XenbaseID:XB-GENE-981839 Length:353 Species:Xenopus tropicalis


Alignment Length:310 Identity:75/310 - (24%)
Similarity:117/310 - (37%) Gaps:88/310 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GSF-------FALGAYYQHIDVMRKIRRLEQRNPHAYFIRRKLYALLGIFAVRPDNSEFDVDTDD 73
            |||       |.|||.......:..::..|:|.|.          |..:..|:.|..|       
 Frog     3 GSFSRRFLGGFVLGAAASSASCLAALQLYERREPQ----------LAPVAPVQKDPLE------- 50

  Fly    74 CHKLGGIMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCERVDLSNRVVYGDST--------- 129
                    :||||.|. .......:...|:|.......|:.|.  ||...:.|.:.         
 Frog    51 --------EYGFPLTG-YEARHYINHALSYDPAKRTPKWVIEH--LSGTKIVGSADRKHCKFKPD 104

  Fly   130 ----------------------SVAPAG--AFGQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQY 170
                                  .:||||  .|.....|..|:||||.| .|...|...|:|:..|
 Frog   105 PNIPKMFSATNEDYLRSGWTRGHMAPAGDNKFSTEAMAETFYLSNIVP-QNYENNAGFWNRMEMY 168

  Fly   171 VHEMSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTM--------VAVPTHFFKILVIDKKF 227
            ..::::|...|:..:|.:.||.        |....::|.|        |:||:|.:|::::..| 
 Frog   169 CRDLTKRFEDVWVVSGPLELPT--------LHEDGKKRVMYEVIGADDVSVPSHLYKVILVRGK- 224

  Fly   228 AGDTIPYA-EAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFEGLDRN 276
             |...|.| .|:|:||||:..:.:|......:.::|..:||.||..|||:
 Frog   225 -GSEQPLAVGAFVVPNSPIGFDRQLPEYQVQLEDLEKMSGLVFFPQLDRD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 54/218 (25%)
exogXP_031760009.1 NUC 66..273 CDD:214683 55/219 (25%)
Exog_C 292..336 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.