DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and KLK4

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:256 Identity:82/256 - (32%)
Similarity:129/256 - (50%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVS-VQNNSLHCCGGVIYSDRAILTAAHCLS 72
            :::.:||    :.:.|...:|:.|........|||.: |..|.|. |.||:...:.:|:||||..
Human    15 LILGVAG----SLVSGSCSQIINGEDCSPHSQPWQAALVMENELF-CSGVLVHPQWVLSAAHCFQ 74

  Fly    73 NVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRLGGTVKKIPL 136
            |.....|.:.:..:....|.|:::...::.||:| .|.|.|  |:.::.|:..:....|::.|.:
Human    75 NSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLAN--DLMLIKLDESVSESDTIRSISI 137

  Fly   137 AEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK---HVNITIDMICADG- 197
            |.|.|.||...|.||||......  :..:||.|:|::::...|.|.|.   |.:    |.||.| 
Human   138 ASQCPTAGNSCLVSGWGLLANGR--MPTVLQCVNVSVVSEEVCSKLYDPLYHPS----MFCAGGG 196

  Fly   198 -QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDG-CGT--NPGVYEDIAFFHNWIKYTVK 254
             .:.|:|.||||||||   ..|:.|  |:||:|.. ||.  .||||.::..|..||:.||:
Human   197 QDQKDSCNGDSGGPLI---CNGYLQ--GLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 75/230 (33%)
Tryp_SPc 29..250 CDD:238113 76/230 (33%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.