DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and PRSS27

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:273 Identity:89/273 - (32%)
Similarity:129/273 - (47%) Gaps:23/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTA 67
            |.|||......|..|.|...|....|:|||........|||||:|.|..|.|||.:.:::.:|||
Human     9 LLLLLCFGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTA 73

  Fly    68 AHCLSNVTVTDL-SVRAGSSYWSKGG---QVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLG 128
            |||..|.:.|.| .|..|:....:.|   ...:|.:..::|.| ....:..|:|::.||||:...
Human    74 AHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLY-QGTASSADVALVELEAPVPFT 137

  Fly   129 GTVKKIPLAEQTPV--AGTIVLTSGWGYTRENSSFLWP-ILQGVHVAILNRTDCLK--------A 182
            ..:..:.|.:.:.:  .|.....:|||...|......| |||.:.|.|::...|..        .
Human   138 NYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFG 202

  Fly   183 YKHVNITIDMICA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDI 242
            |:...|..||:||   :|:: |.|:|||||||: ...|......|::|||:||.  ..||||..:
Human   203 YQPKTIKNDMLCAGFEEGKK-DACKGDSGGPLV-CLVGQSWLQAGVISWGEGCARQNRPGVYIRV 265

  Fly   243 AFFHNWIKYTVKK 255
            ...||||...:.|
Human   266 TAHHNWIHRIIPK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/240 (33%)
Tryp_SPc 29..250 CDD:238113 78/240 (33%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 78/240 (33%)
Tryp_SPc 36..275 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.