DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and 4930519F16Rik

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_011245990.1 Gene:4930519F16Rik / 75106 MGIID:1922356 Length:604 Species:Mus musculus


Alignment Length:256 Identity:61/256 - (23%)
Similarity:105/256 - (41%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL--SN 73
            :|::..:....:|..      .|||.|   ||..|:.:|    |.|.|.:.|.||:.|:||  |.
Mouse    26 LSVSSSSVTGNLPPT------NSYIDI---PWLASMPDN----CQGTILTTRLILSTANCLKKSK 77

  Fly    74 VTVTDLSVRAGSSY--WSKGGQVLKVLKTIAHPKYVPKLYN---PYDIAVLILEAPLRLGGTVKK 133
            ....|:|   |.:|  .:..||     :...|||:.....|   ..||.::|||.|:    ...:
Mouse    78 PLYLDIS---GVNYPESTSHGQ-----RICLHPKFNLNDENDPMKADIGLVILEKPI----DGDE 130

  Fly   134 IPLAEQTPVA----GTIVLTSGWGYTRENSSFLWPI-LQGVHVAILNRTDCLKAYKHVNITIDMI 193
            |||::....:    ......|.:.|..::|..|... ::.:.|.:|:.:.|...:..:...:. :
Mouse   131 IPLSQSPSTSLKSCSKCQYKSCYVYEYQSSKKLGTSRVKKIDVQLLDFSMCYPQHSSLEKAVG-L 194

  Fly   194 CADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTNPGVYEDIAFFHNWIKYTVK 254
            |...|..:.|......|:: .....|.:|:|::........||.|....|.:..|||..:|
Mouse   195 CIQSQPREDCWVQRASPVL-CLLMNHWELVGLIHKTSKICQNPAVIIRTAPYFTWIKQFIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 55/232 (24%)
Tryp_SPc 29..250 CDD:238113 56/232 (24%)
4930519F16RikXP_011245990.1 Tryp_SPc 47..251 CDD:389826 53/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.