DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and TPSAB1

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:278 Identity:100/278 - (35%)
Similarity:139/278 - (50%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLLSILVSIAGLACAARIPGPEER---IVGGSYIPIEYVPWQVSVQNNS---LHCCGGVIYSD 61
            |.|||..|..:|..|.||..||...:   ||||...|....|||||::.:.   :|.|||.:...
Human     2 LNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHP 66

  Fly    62 RAILTAAHCLSNVTVTDLS-----VRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLIL 121
            :.:||||||: ...|.||:     :|....|:.  .|:|.|.:.|.||::....... |||:|.|
Human    67 QWVLTAAHCV-GPDVKDLAALRVQLREQHLYYQ--DQLLPVSRIIVHPQFYTAQIGA-DIALLEL 127

  Fly   122 EAPLRLGGTVKKI--PLAEQTPVAGTIVLTSGWGYTRENSSFLWP--ILQGVHVAILNRTDC--- 179
            |.|:.:...|..:  |.|.:|...|.....:|||.. :|...|.|  .|:.|.|.|:....|   
Human   128 EEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDV-DNDERLPPPFPLKQVKVPIMENHICDAK 191

  Fly   180 --LKAYKHVNITI---DMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPG 237
              |.||...::.|   ||:||...|.|:|||||||||:....|...| .|:||||:||.  ..||
Human   192 YHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQ-AGVVSWGEGCAQPNRPG 255

  Fly   238 VYEDIAFFHNWIKYTVKK 255
            :|..:.::.:||.:.|.|
Human   256 IYTRVTYYLDWIHHYVPK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 85/245 (35%)
Tryp_SPc 29..250 CDD:238113 86/242 (36%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 86/242 (36%)
Tryp_SPc 31..267 CDD:214473 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.