DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss55

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:272 Identity:94/272 - (34%)
Similarity:131/272 - (48%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAGLACAARIPGP-------EERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDR 62
            :|...|:.||...|..|   |       ..||:.|....:...|||||:|.:..|.|||.|.|:.
Mouse    33 ILTECLLCIASSECGVR---PLYDSRIQYSRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEW 94

  Fly    63 AILTAAHCL--SNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPL 125
            .|||.|||.  ..::.|||.||.|::..:.....|:|...|.| |...:|....|||:|:|..||
Mouse    95 WILTVAHCFYAQELSPTDLRVRVGTNDLTTSPVELEVTTIIRH-KGFKRLNMDNDIALLLLAKPL 158

  Fly   126 RLGGTVKKI--PLAEQTP------VAGTIVLTSGWGYT----RENSSFLWPILQGVHVAILNRTD 178
            ........|  ||....|      ||       |||.|    :|:.|   ..|..|.:.|:...:
Mouse   159 TFNELTVPICLPLWPAPPSWHECWVA-------GWGVTNSTDKESMS---TDLMKVPMRIIEWEE 213

  Fly   179 CLKAYKHVNITIDMICAD--GQRWDTCQGDSGGPLIETTKGGHR-QLIGMVSWGDGCGTN--PGV 238
            ||:.:.  ::|.:|:||.  .:.:|.|||||||||:.||..|.| ..:|::|||..||..  ||:
Mouse   214 CLQMFP--SLTTNMLCASYGNESYDACQGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGI 276

  Fly   239 YEDIAFFHNWIK 250
            |..:|.:..||:
Mouse   277 YTVLAKYTLWIE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 85/239 (36%)
Tryp_SPc 29..250 CDD:238113 85/239 (36%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 85/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.