DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and LOC683849

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:261 Identity:89/261 - (34%)
Similarity:138/261 - (52%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLACAARIP-GPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHC 70
            :|.|:.:|.:..|...| ..:::||||.......||:|||: |:..|.|||.:.:|:.:::||||
  Rat     1 MSALLILALVGTAVAFPVDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHC 64

  Fly    71 L-SNVTVT----DLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGT 130
            . |.:.|.    :::|..|:.      |.:...|.|.||.:..|..| .||.::.|.:|::|...
  Rat    65 YKSRIQVRLGEHNINVLEGNE------QFVNAAKIIKHPNFDRKTLN-NDIMLIKLSSPVKLNAR 122

  Fly   131 VKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICA 195
            |..:.|......|||..|.||||.|.........:||.:...:|.:.||..:|.. .||.:|:||
  Rat   123 VATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPG-KITDNMVCA 186

  Fly   196 ---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVKK 255
               :|.: |:||||||||::     .:.:|.|:||||.||.  .|||||..:..:.:||:.|:..
  Rat   187 GFLEGGK-DSCQGDSGGPVV-----CNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIEDTIAA 245

  Fly   256 N 256
            |
  Rat   246 N 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 80/230 (35%)
Tryp_SPc 29..250 CDD:238113 81/230 (35%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 80/230 (35%)
Tryp_SPc 24..242 CDD:238113 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.