DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:256 Identity:86/256 - (33%)
Similarity:129/256 - (50%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN 73
            |.::..|.|.|..:...:::||||.......:|:|||: |:..|.|||.:.:.:.:::||||.. 
Mouse     5 IFLAFLGAAVALPLDDDDDKIVGGYTCQRNALPYQVSL-NSGYHFCGGSLINSQWVVSAAHCYK- 67

  Fly    74 VTVTDLSVRAGS---SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIP 135
               :.:.||.|.   .....|.|.:...|.|.||.|....|| .||.::.|:....|...|..:.
Mouse    68 ---SRIQVRLGEHNIDALEGGEQFIDAAKIIRHPNYNANTYN-NDIMLIKLKTAATLNSRVSTVA 128

  Fly   136 LAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMIC---ADG 197
            |....|.|||..|.||||.|..:.:....:||.:...:|:.:.|..:|.. .||.:|.|   .:|
Mouse   129 LPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPG-KITSNMFCLGFLEG 192

  Fly   198 QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIKYTVKKN 256
            .: |:||||||||::     .:.||.|:||||.||..  .||||..:..:.|||:.|:..|
Mouse   193 GK-DSCQGDSGGPVV-----CNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTIAAN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/228 (34%)
Tryp_SPc 29..250 CDD:238113 79/228 (35%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 78/228 (34%)
Tryp_SPc 25..243 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.